Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Greeting Cards
2 product(s) found for "Greeting Cards"
Greeting Cards
"Christmas Truce"
This hand painted card is to remember the incredible moment amongst brave men around Christmas. 15 x 15 cm. Acrylic paint. "The World War I Christmas truce was an informal series of ceasefires on the Western...
£5.00
Units in Stock: 9
£5.00
Details
Add To Cart
This hand painted card is to remember the incredible moment amongst brave men around Christmas. 15 x 15 cm. Acrylic paint. "The World War I Christmas truce was an informal series of ceasefires on the Western...
Greeting Cards
"Til Death" - Valentines Day..
"Til Death" Valentine's day card. For those with a Romantic Vampire Heart wanting to give to your eternal true love ,
£5.00
Units in Stock: 5
£5.00
Details
Add To Cart
"Til Death" Valentine's day card. For those with a Romantic Vampire Heart wanting to give to your eternal true love ,
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i